PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03050.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 247aa    MW: 28791.1 Da    PI: 5.9792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03050.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEd++l+++++++G  +W++ +++ g+ R++k+c++rw +yl
  Rsa1.0_03050.1_g00002.1 14 RGPWTPEEDQILINYINLYGHSNWRALPKHAGLLRCGKSCRLRWINYL 61
                             89******************************99************97 PP

2Myb_DNA-binding50.25.9e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T++E++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  Rsa1.0_03050.1_g00002.1  67 RGNFTPQEEQTIINLHEVLGNR-WSAIAAKLP-GRTDNEIKNIWHTHL 112
                              89********************.*********.***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.265961IPR017930Myb domain
SuperFamilySSF466894.93E-3110108IPR009057Homeodomain-like
SMARTSM007172.2E-151363IPR001005SANT/Myb domain
PfamPF002496.2E-171461IPR001005SANT/Myb domain
CDDcd001671.97E-111661No hitNo description
PROSITE profilePS5129424.80962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2665117IPR009057Homeodomain-like
SMARTSM007174.6E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001672.01E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRAPCCEKM GVKRGPWTPE EDQILINYIN LYGHSNWRAL PKHAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPQEEQTIIN LHEVLGNRWS AIAAKLPGRT DNEIKNIWHT HLKKRLNKDQ  120
NNNGGVTKDL NRTNETTHED KESVIVDTTS TQQFRTLQIS NNNNADAMMS YEDISAMVDE  180
SFWSDVISVD NKNSTEKTME DWEGLLDRNS KIYSYNNSKL YNDDMEFWFE VFSSSRRIEE  240
FSDVAEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625134.11e-166PREDICTED: myb-related protein Myb4-like
RefseqXP_013746603.11e-166PREDICTED: myb-related protein Myb4-like
TrEMBLA0A078D6Q11e-167A0A078D6Q1_BRANA; BnaA03g14350D protein
STRINGBra022831.1-P1e-165(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-154myb domain protein 14